TCDB is operated by the Saier Lab Bioinformatics Group
>SNV19554.1 Uncharacterised protein [Dermatophilus congolensis]
MQLSRCERVVFSGFLERIGGAGRRACLFGAGLVVAAVVLLCVVIPFFVWTRLGQRVDERSRWSALLPPEVNERFDAVLTL
VSVPAVAVGLLVVVGIALLRRRWDLAVFAVVLVGLANVTTQVGKVVIPRRDVGIGAENTLPSGHMTVITGLALALLVVVP
RLVRVPLMMLSAFACTLAGAVIVVMRWHRPSDVVAAVGVLALWSGVAVLVAVWLRSRGRDVGLEGSVSVRGVVAYGVVAL
AGSVAAGVVLIALGLVAHEEPSNVVVAAVTFGAIGVATCVLMVLSVVAVDELDCVSAGSSTAGGELGD