TCDB is operated by the Saier Lab Bioinformatics Group
>tr|T0PIV6|T0PIV6_9STRA Uncharacterized protein OS=Saprolegnia diclina VS20 GN=SDRG_16831 PE=4 SV=1
MIYPVDAVLKAPAQSKLMALPLLYLLQSLDKTFLDRVLAVLGHTDGRDKTVKIVQYFCKLALALNQAKYKPLIGTLAKQL
SGARRVMRLGKSLKVVNNSLDALAEPAGWQRTAAMLSVCAGTVGDVGDDLCWASDMALAPSWIGAYDVWVDRLWFFTLCC
DLPLNTCAILDARAALVACDPEADPVAYHNCQVKLASVTIAQIKAVADFFHATRLAFNWPTGSTGQDAVCGLVSASCSLV
KMWKPAFLTKAP