TCDB is operated by the Saier Lab Bioinformatics Group
>TAL14146.1 hypothetical protein EPN95_04030 [Patescibacteria group bacterium]
MNVVFVFAGLAVVLFVSAFITRRRFGLLGLALAAGSILSGIWSFDAGLVVGTIGVIPPGPLTTSITLGLIVLLPAIVLLF
HGYTYKSLLGRIVGALLFTLLALAFLVTPLGFGLPLSGIGANIYAQLVKYKEVIISIGLVIAVIDLFFTKPAAPLLDRKS
KR