TCDB is operated by the Saier Lab Bioinformatics Group
>TET83512.1 TIGR00266 family protein [Anaerolineales bacterium]
MADIIEYKIYGDDMQLVEIELDPGEGVRAEAGTMTYMEDGIEMQTSTGGGIFKGLKRAITGESFFITTFLNNGNGKSHVA
FAAPYPGKIIPVNLTQFGGRILCQKDSFLCAAQGIEIEVAFTKRIGTGIFGGEGFILQRLEGDGLVFMHAGGTIVEKDLV
AGETLRVDTGCLVAFAANVDYDIQFIGGFRNALFGGEGLFLTRMTGPGKIYLQSLPFSRIADRVLAAARFQQIGQKKGVA
GIGGKILGDIISGG