TCDB is operated by the Saier Lab Bioinformatics Group
>TGC20982.1 hypothetical protein CW310_31175 [Pseudomonas citronellolis]
MFLWALVVALLALRVGNHNLILASLWAEDGTVFLNQANAIGFHSLWLPYNGYLHLYPRITALLATWLPLSAVPLFFNVSW
FLAVAAAAFSLYYFARKQAFGPMACLLLIACVLLQPSGGETLFTLTNAQWFIGIALILYICGPNNPKPSPATYLALALAA
LTGPFALIALPVLLVQSLYARKAMPSLGSCLILLICSGIQLYFLINSDRMGGGRVLDTNYQHWLKALWTSLSFGLSSRAG
SICALAIWVIFLTATAKQLRSGNRQAITLQISLLFLAGLLLAAGIMTEKQAPHTLSPLGAGSRYYLIPYTLLIVSAFLSL
RRYPVLGLLALLLFSIICTKGFMKLDRGELQWPAYTRLAKIAAPLYIPIAPNTGAFPGWSVYTEAPTHPGRTIGLPLENT
YTYNAQASIQPEGLGIQPTSSDPLIRFVIPACTDSRYIGVIINAWREQDGFVQMFWGKDFAFDEQHSLRRYYPAGDTTIQ
FAYERRETDNTVRLDPSENQGKIVIRDIQLSCLGD