TCDB is operated by the Saier Lab Bioinformatics Group
>TSL61117.1 Epidermal differentiation-specific protein [Bagarius yarrelli]
MRMLLLLPLLIIKRVSDLVSGVSGLGVYTETDISSCGSPKVCMNTSINMGLMRVSNFTHCCNTDICNNKTVTAALSEDIN
GRKCYTCTDMGCDQTLHCEGEEDRCISATVIGNPWVAYTGAKFEGIPTVYEEGEYPNVYYNDDISSLELVTEDLHNPQIT
LYEEENYKGRSLVLHCETNLLYGTFNDTTSSHKVQRGAWVLYQHQNKGGYIEVARAGRDVPQYTWFDNRLSHVRPMKPGN
SSVKAEIQWDKKTVNTKSVIINSITGVNYGSEKQTFTTELSREFSGSVTESFVFSNSTHVSYGTKFSFSLYGVSQEHSFN
ISNTFTVEKGSSNTRTTTKSIKVTLPASIPPGTKLTVNIVRKEVTVRVPVMLTITSNSNTVVEYGEFFCEDGNTIDTEFR
EEKISR