TCDB is operated by the Saier Lab Bioinformatics Group
>TVP80452.1 DUF935 family protein [Puniceicoccaceae bacterium]
MTPLLLNRILDSYRSQLNPLRGLTIRRVVSLLEEGERGAYADLQWLYRFVEKRDATLRGVKRRLRSAVTKLDWDIKVIDE
LPAGKQAVADRQHEALRLAYERVENLREALAFLSLAELRGYAHLEKVFEKDGNGGLVIARLEPVPQWHWCRDGLYSDWTF
NPESASGLTLGEPVDLEQFVIREVEDPIDEIAVIAFIRKNLSQKDWDGFVESYGIPFLFLIMAQNAGDKDSKEFQAVVEQ
IASDSRGVLPHGSEIKTADPGNRGQNPFRAHLDYQDEQIVLAGTSGLLSMLSKPTGIGEGASNEHGKTFEEIALAQAMDI
SEILQEHFDKRILAEQFPGEERYVYFELAARDQEDVSSLFDNALKASQAGLAVDAEEMSEKSGLKLTRSEQGAESRERGA
GIAQPIRNRIHNRDTPPINPAETEALARARLADHADLLALVDALEAADTPEDYAEAMAALEAAIEAREIDPAQSSFAETL
EALLGSAVIEGAAEISEKATEAPTNADNA