TCDB is operated by the Saier Lab Bioinformatics Group
>TXH42089.1 DUF935 family protein [Desulfurellales bacterium]
MASPKSGFVRSAAARALTGLFGFAGLSAPQVEAANLKPAPPIETVPVTTPAAPGFGPRYTTAHDQTAYVELSRAYEALFG
RISNRLGPTNPRWNTFSGDLKPETILDAIQTANAGIPFVLCDMYRRAVEQDAHLSGLVLKTFSDIVVTPDRIEPPESLKG
DPLAENIAIWQRAAREQIENFDEARFGLLWAEGQSYAAAENIYDFRRIRWRTKDGRSISREYLVPIRLEIVEGRSFRFDM
ETDDPLLWIEGDYLTLPPGKFVFHVANGVTQIKERRGFMRSCLFLHAIKQWTIRDCAEFLHIYGIPQMILEYSPKSYEYP
AAQELSRKLREWMGQGGIPAVPAEQVRLRNDTPPPDGALVHTQAGDWLNTEMTKAVTASGPLTMESGGGNYGLGDVHASG
GYNPQLLRARGLYKSIRWGTYWPTLQLNKYRLAGDLGETPDDILASFSGYSPQIEREQDPEKRQKTFSQAMKDGCTVSLA
QYRNVLQLDAPKDKDDELRGEGQPIPSSGAIVSAVDASDGAEAPIPGKTAPSVGVTNPERPSDRDETPKSSGGVDLTATA
QAAVITVDEAREKMGLGPWKDSAEGSLTVTEFIAKHSGVIAKSADAESGDASQEKDS