TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U2JAA3|U2JAA3_9STRE Bacteriocin cerein 7B family protein OS=Streptococcus sobrinus W1703 GN=HMPREF1557_00793 PE=4 SV=1
MEEYMNSIAFNDFEIVDSENLVEIGGRFNVWGATIGFAGGFIGGAIDGAGKGLIAGTAAEPGAGSVVGAVLGGIGEGLIA
GTTCGIAGSQV