TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U3IVC3|U3IVC3_ANAPL Uncharacterized protein OS=Anas platyrhynchos GN=GHITM PE=4 SV=1
MLAARLVCLRTLPCQALRPTITQASPALRNSGIKAYQLWQPNQCYATRVRTGVRRGKIGQEIKEAAFEPSAETALKVDRL
GKFVVAGGAAVGLGALCYYGMGMSSEIGAIEKAVIWPQYVKDRIHSTYMYFAGSIGLTAMSAVAVSRSPALMSLMTKGSW
LAIGATFAAMIGAGMLVRSISYENSPAAKHLAWMMHSGVMGAVVAPLAFLGGPLLIRAAWYTAGIVGGLSTVAMCAPSEK
FLNMGGPLGIGLGFVLASSIGSMFLPPTSAFGAGLYSVAVYGGLVLFGMFLLYDTQHVIKRAETLPYYGVTKYDPINACM
GIYTDTLNIFIRVATMLAGGGGGRR