TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V1H2L8|V1H2L8_SALHO Uncharacterized protein OS=Salmonella enterica subsp. houtenae serovar 50:g,z51:- str. 01-0133 GN=SEH50133_15951 PE=4 SV=1
MESKPLISNIIVSASLLFFSSLTIASTEKCNNLNEQEIISQISTDFLNNRASVWPENLMGNIGTKKPELVFSKNTIINKE
IYGIPFEAIGPKNKTNFIGLYDCRTGKIEYSKE