TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V1L9U1|V1L9U1_SALET Uncharacterized protein OS=Salmonella enterica subsp. enterica serovar Tallahassee str. 0012 GN=SEET0012_10512 PE=4 SV=1
MELFRKTLGGLKTSYYIRHFIFGAIISTFFIYISMQNPSGMKVANVIFFVINALLYPYARFVYEQVISFIMGENVFFINA
IVMLMAKVITMCLCWIFSIFIAPVGLAYLYYYHSKGD