TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V2RIC7|V2RIC7_9BACT Uncharacterized protein OS=Mucispirillum schaedleri ASF457 GN=N508_01375 PE=4 SV=1
MRKLIIFPTLLKSLFYQGNWNITNMQGTGFRWLLKDFFRNNKTELPSDFDSSPLYYFNTNPYLVTFILGLLLKETQEKSK
IGDYDKIYSSALAALGDTFFWHSLRPFAFFVSIWAIVVNPVLLIILYLVVFNLFNIVFRVLGFYYGYTFGANVIFLFNKI
GFNRWSTVFDAMTTFMAGIVIAYLIKYQYYEGFIHFVKLVLLFIVGIIISKWVRGPLELIIVTTILGVLLLFGV