TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V5BTU4|V5BTU4_9BURK Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase OS=Burkholderia cenocepacia KC-01 GN=P355_5004 PE=4 SV=1
MNDTPSRLPLNRITLVLLLVALAIVWFAPLGLRHLIPSDEGRYAEMAREMFVTGDWITPRYNGYKYFEKPPLQTWLNALT
FAWFGIGEWQARLYTAVASFAGVLLVGYTGARLFNPLSGFLAAVVLASAPYWNLMGHFNALDMGLAFWMALSLCSLLLAQ
RPGLRPAAVRGWMWACWAAMAFAVLSKGLVGLILPGAVLVLYTLIARDWALWKRLYLVSGLVIFFAIVTPWFVLVQQRNP
EFFDFFFIVQQFRRYLTPEQNRPGPLYYFVPVLLVGFLPWLSVAWQSIRHALRMPRQPNGFSPMLVLLIWSAFIFLFFSA
SHSKLISYVLPVAPALALIIGAYLPLMTAERFRRHLLGYLVFFVAAAFGIIFLAYQGDARTPNALYRAFQMWLYAGLAVS
AALTLAAAWLNRRAGVAAALAAFGAAWLAFGTIGGTGHDEFGRYSSGALLAPAVRAELAKLPPDTPFYSIEMLDHTFPFY
MGHTTIMVQRQDELAFGISVEPNKWVPTVGEWITRWKQDTHALAIMPPGQYDALVKEGVPMRVIARDNRRVIVEKPQS