TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V5SJJ8|V5SJJ8_9RHIZ Uncharacterized protein OS=Hyphomicrobium nitrativorans NL23 GN=W911_09015 PE=4 SV=1
MFADGEFAMSGCLFSSEPDTMAAAPAANPHSPPPPLDVIPASLWAPRRSDAWWWLYLPLVLFAALLTISLAWPDFYRAYI
LPEGYGFLELGHFLIPFAAAILSLRLLLLRLVRESWPLWLFILVFGLGNFYIAGEEHSWGQHFFNWSTPAYWSELNRQAE
TNLHNVSHWFNHRPRLVLEIGIAIGGILIPLIQSRAGLFRQPLLALLTPPVQLTVVAVVALVVKVINHLWKGDVVGKELL
IRPSEALETFIYLFLIYYVIVLGRRLSALDAAGVRHVPL