TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V5X3H3|V5X3H3_PAEPO Uncharacterized protein OS=Paenibacillus polymyxa CR1 GN=X809_23760 PE=4 SV=1
MIEQYVTTIALSVICLITIGALTLGTAVYRKLKPLYEARFSVEQRNRIGQLAGDAYAWVERNYAGAGAEKFREAVKYLTI
KLDQIGVSIKPEEVEAAIQKAWEEFNPNKIKSV