TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V7E482|V7E482_PSEFL Uncharacterized protein OS=Pseudomonas fluorescens BBc6R8 GN=MHB_003442 PE=4 SV=1
MVMKVRLRWYDKQSNYVKADEYSGDIDDAESFFETLGLSQETAIYADVFNVRPSWIATIQPHFQHVIEPVNFDYQISFSY
QGTWPPQSSKKP