TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V9D2C4|V9D2C4_9EURO Uncharacterized protein OS=Cladophialophora carrionii CBS 160.54 GN=G647_08176 PE=4 SV=1
MTTSSPLTLPTAGVGGAYYDKVFQVPVYPNSPSDLATWRVIDTWNNISVSYATTQGIATGLVWATLTYLLALTPDSKRTT
PFHSFMLVGLVFLLIHMMIDVVSNLTPGLQTVSAYTAVTFDLANSIWTTKFVATFAASQVTAWFAFAFAVICLWVQAKGL
MTGLRVRRPGVYKIVMTYLVLTSIAGLAAAMAFSIHQITVLGQPATDDEHSIDVAYTARVAYLSSVAICIGSYSFVSMLA
VVDIVWKRRTAISGGGPYASALNLVALLCAQSFVIPFIFCVLQLLPLQSGMMHPEIMLLPAVYLILPLGSLFMTVNSNSN
PHAGDAQSPWTPAFPPSNCRASAQDAYADSDMTLTHLTAHPGPRPTSQVHGGAHIDRELSTIDAMECGVGARGRRKTDAE
AETMLLNKDSQEKEVVVRPRVAT