TCDB is operated by the Saier Lab Bioinformatics Group
>VDK37503.1 unnamed protein product [Taenia asiatica]
MQKQSKFAIFCDLTSIRGVQRIKRAQTPFIRIIWSLFVVLMTGALIITIGFLARDFFSFSTSWHSRTLIDDKTDFPAITI
CAHNPFALEANHIWAKASILTPSEFNRQLSAITLAFIENGNLEYASLLLQDSTDTYFANLRPEESRRLGHQTTMFPHCMV
TVDGVNIVAENCTIEGDTGFTKQRFSHPKYFNCWTIETADNKSTKDTVRLTLLLSLVSSKEINESRKNFVMDTFSRGEGV
KLVVHQSGTYPEIDKHGINVQPGRMNELSFNTERWVRLQTPTAPCLDDPPPITDMGKQYSYRMTQCLDSFLQNISINQCG
CLNSEWPRPIHPDLVNTNVPYCSALPKDARDPTTLESIVKRLNCTTNLLHNLKHIKESAIRERICIPRCSFYTYPLSVSI
ASWEPIPEKLHHFTDKFKRVERLLNNHDDAVERERLVKYLKNVIGLEADDTTQNSSMSNLRIEDFENQESYTYISLVRTS
YETTYKEERLIFDIYILISRVGGLCSIFIGLTAAIFVELIEFIYVVFWHVDTTSGPEDPQPLTSSELPLQGNKGHSESTL
PSDKSYDDVKPQRQCIL