TCDB is operated by the Saier Lab Bioinformatics Group
>VDL87707.1 unnamed protein product [Nippostrongylus brasiliensis]
MILQTLKLISSEGFATWMFQGLTFLLPFLVVAYVLELYNAYTLYSLWTTQECVWQGNIHGVAVTERVQPAQAAALILVLK
LLNQRNVCCEQEELRVECLNKEDYNGKECKTPRLNVNLNSSSQIAPVFCTI