TCDB is operated by the Saier Lab Bioinformatics Group
>VDL90262.1 unnamed protein product [Schistocephalus solidus]
MCPTGRLLPESQCGFRRHRGTIDMIFAARHLQEKCQEMRTHLCTTFVDLTKAFETVNCNGLWKIMQKFGCREPFTHMVWW
YAQGRLWPRQPPAPSPASGLLDTVMAPGSGGGGGESAVDAAPVYYHFKLNHAHVTVLAPPFRGACGGHRQTTTVELSDGY
MTWMSSRLSFLLIFLMGAYVFQICNAYSLYLIYMQQTCKEWHPLVVGLINGFVASGNLLTTLYVVRQKCTRLSPVKRKHL
SKKYSTKYVHASDLLCDRSEDIPTRKAL