TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W0RFP8|W0RFP8_9BACT Phosphoesterase PA-phosphatase related protein OS=Gemmatirosa kalamazoonesis GN=J421_1705 PE=4 SV=1
MLGGTDAAIAGGFALGTLGAFALDRTLAERLQRPGVRRSRALSRTATVFRLAAQPGVLVGLPVVYLVGRATKQDGMADVG
LHGTEAVAVALVSTTIVKAIVGRARPAVDVHDPSNVALLRGITRGGEFQSFPSGHATTAFAAAAALTAETVRRRPDARWL
VGVPAYGAASLVGWSRMFDNRHWASDVVAGAGFGTLAGVAVVRYQHTRPRNRLDRWFLGASIDGRGAVPMAFVR