TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W6ZND1|W6ZND1_COCMI Uncharacterized protein OS=Bipolaris oryzae ATCC 44560 GN=COCMIDRAFT_96534 PE=4 SV=1
MSDEEKKPLDAPDTTDATETPEAKEAVDKIADAAPPARPTTVSKTGLLAGVKKADETILRLNKLLASPGGLSAFLSTFNY
TLYILAYAQTKSPAVSAFATRLLSLIRPACDDTKIPATTLVDNGTVPPIAALAVLISKTRTTLRLTGTLPLYAWLRSLAS
GPKPGTDVVLHRIATLQAMSYFVYQLLENISLLADSGVISPRVVSALNRGDPKTARLYLYTYRCWLGGVSCDFLRLMREW
QIEGRRRLTRQQMVSEGKAIAEYQDDEDKKFDKRWWTDFVIASAWFPMALHFSSANGGIPGWNLGIMGACGLIAGSTRMK
ALWASTA