TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W9K2M0|W9K2M0_FUSOX Pheromone alpha factor receptor OS=Fusarium oxysporum Fo47 GN=FOZG_10125 PE=4 SV=1
MSTFDPFTQNITFLAADGNTTISIPVVLVDEMRRMMVNTVINYATQLGACLVMLVVLLVMVPFSKFRRPFNALQIISLFI
CSCRMVLLCIWNISKFADFYPFWSHDFSHIPRSEYAPAIAANIISLLLVISIETMLMSQAWTMVKLWPNMWKYIIAGLSL
VISLMTICVRIAFTAVQNKAVLDTIPPLHMLWLIKWTVIMNVSSISWWCAIFNIKLIWHLISNRGILPSYKTLTPMEVLV
MTNGILMIIPVIFASLEWAHFVDFEAASLTLSSVAVILPLGTLAAQRIAASNANSAHSSGASNGIRYGASGPNSFTGFKA
PSFSTNRSGATDRPHVSVYARCEAGTSSRDHINPGDVELGKIDSDHVRVDKAFLQREERI