TCDB is operated by the Saier Lab Bioinformatics Group
>WP_007636456.1 hypothetical protein [Paraglaciecola psychrophila]
MTFRISEYSKIEITQVVDVRTTAKNKYNRARIEGPNRAFWQIDITTPPLPYAEAMGVAAYLDSLKGSLEIIEVPNPLPEL
ATRTGLTTLAIDAKESKTVQINGFSNNQSGAVVAGDFVQHSTSQKVHRIVNTANAGATGNLTATVTPELYADTAAAGAFK
YGNAVSFQCCLDEYYSMEVLASKGKFVVFNIRLLEQG