TCDB is operated by the Saier Lab Bioinformatics Group
>WP_010036673.1 hypothetical protein [Gemmata obscuriglobus]
MANDLIANLNNPAERRKSVRLRVRPDLQSFEQKYEGKTFTVIKDPVCLRYYRFSRQEHFVFGLFDGKHTMEEVQEAFEEE
FKPMRLELADLEGFARQLVTAGLVQNEQPGAARHLFERRAKQRRMRRLATVSNILYLKIPVFDPDRLLTWMYGYLRWVFT
AWFFAASVGLMLAAIVHVTLHYNTFQAKLPAYQEFFTWNSVLYMWLSLGVVKVIHEFGHGLSCKAFKGECHEMGVLLMCL
SPALYANVTDAWTLADKWKRIIISFAGIYVELVIASIATFVWWYTPAYPTANNIALCIMVLCSVSTVMFNANPLMRFDGY
YMLADWLEVPNLREKANRFLNNLFLSKCLGVDVPPEAYMAPWRKWLFVIYAVGSWVYKWVVTFSILWFLADFMGPKLKVL
SQMLALMSLASVFVFPTYKVIKNIRQRGRLPDMKAARVYITLAVFAAFVAAFFFLPLPVSRVHETGLVAIDPEHLEGVML
SEPARLVKLEGASPGQAVRKGQLLGTFESTALEIELAKAKAARATQQQTADMLNKKVLKAQGAGDAANEQRFLNEYVRAK
AQADTAERDVARLLKRQIGVRELRATRDGTLITAPKRDEIGKLFDKGYTETTPVFSVGDPLKLVLKVPVTPYDYRLLKED
LTARSELDVSVCVKGRSDRTFSGKVHRDKLPAQNAATIPLALSQRGGGSLAVKPNEDPNLLAPLAQVYLVEVEMTDPDTA
IDPGQLVSVKIHSRWRSGAWWVARELSNALDIGLY