TCDB is operated by the Saier Lab Bioinformatics Group
>WP_014620776.1 DUF2919 domain-containing protein [Shewanella baltica]
MNFSHITWLDDKGHIKPPIFLYALLAYLARGWCIFIASLTQMGDRSELVRIFYPEKSDFLLALGAGLGAVLIYLVVIAER
RRSPQWLRPIFVHLKWGLWLLLMIDGVLLGQRLIHGQFLFHWSLALDALILFWSGIYLIKSKRLSYYLRDWPKEEPKELQ
P