TCDB is operated by the Saier Lab Bioinformatics Group
>WP_015052797.1 AIM24 family protein [Methanolobus psychrophilus]
MPRYTMEEFIKTTGQKDLGEGKFELERDRLLEVNLDGRVWIKRGAMVAYLGNVKFTREGVLEHGLGKFVKKAFTGEGVSL
TKAEGTGKVYLADTGKKISIINLNNESIFVNGNDLLAFEESVSWDIKLMKRMASMMSGGLFNVKLEGTGMVAITTHYDPL
TLRVTSDQPVYTDPNATVAWSGNLVPELKTDISLKTFVGRSSGESVQMAFRGEGFVVVQPFEEVMYVTTTA