TCDB is operated by the Saier Lab Bioinformatics Group
>WP_019119520.1 hypothetical protein [Brevibacillus massiliensis]
MEPINLSFLQHISAAQVIVLTLLTAITAMAAHLGKAVFHDGIRPIMPEFLEGRMRRPELASISFGLSIGFIVSVGLSFAV
SFQLLNPWLLFLPTDILGVMATSWWLAAILGAAWGLVVLFGLAGVQTVFTLLPVDLIGALGELTTPVLVSFTAFPVLAVL
YQFGWVRALITGISVLIVRQLLPVIGGTFTAKANGFLDQAKQLAGVTFTEKADFAAKVNALKDAAVSNPQVQDLISQASY
NNSLGNTISGFVMQIAVLMLVGMIFLVCFAISKDRAIKKNGADASAEMAAAAEAEANIFDVRTKRIYKGLPLLAAIGALL
AVSCNMGFFTGSDVAGPILQKAWQATGQEQTDLLRSAAVADVIRGISFIPLIVTTALATGVYGVVGLTFVFPLGYLSPNP
VIAAILGALWICIEVVALRGIGRFLQRYPTLRESSDNIRTSMNTMMELALFIGGAFAAMKMAPNAFGLSLTIFILLYAAN
EGLGRPIMRLAAAPVAIIITGILLNLLHFVKLV