TCDB is operated by the Saier Lab Bioinformatics Group
>WP_019546689.1 hypothetical protein [Streptomyces sulphureus]
MSSFTPPTPPSYAQAGPKAKAAKLVTDVLAPGNLVIALLLVVGWHSTHSFAGVGWGALAALFCGVVPIAIIQLGVRRGRL
TDKHVRVRKQRIVPLSASILSVLVGIALLYAFDAPSDVSALVIAMLVGLASVLLVTVWWQISAHNAVAGGTVLILLLVYG
LPALPFVLLLPLVGWSRRVLKAHTLAQLVFGTALGLISAAAFVLLR