TCDB is operated by the Saier Lab Bioinformatics Group
>WP_020086767.1 hypothetical protein [Hyphomicrobium zavarzinii]
MTLSFPSIPVELWMFAAILAAIALFHRFTLVVSLAGLASIVAYKLAVTGFKAGPGLAGLGIHFAHEAVLLANLFMLLTGF
AILARHFEESQVPAIMPNLLPDTWMGGVVLLGLIFVISAFLDNIAAAIIGGTVARTVFQGRVHIGYLAAIVAASNAGGSG
SVVGDTTTTMLWISGVSPMSVLEAYVAAGLAFAVFAIPAALSQHRFQPIMKDAPLGTAIVPGCIAIVVFILVSAIAANVL
ATLYAPEILDRVPLVGLAVWAAIGLAAPLHRPDWSILPDAVKGTVFLLALVSAASLMPIEALPAASVPTALMLGFVSAVF
DNIPLTALAIKQGGYDWGYLAYAVGFGGSMIWFGSSAGVALTNLFPEARSVAAWLQAGWYIPIAYVAGFLAMLALLGWSP