TCDB is operated by the Saier Lab Bioinformatics Group
>WP_020476266.1 hypothetical protein [Zavarzinella formosa]
MTISMPSNGFRSSRFGLETDTAVFRPPQSKGSAQRAIFGPACWMLTVTLPKMNRAAAADWQAFFLLLEGQANTFYGYDPD
GRTGRGVLTGSPLVKGTNQNGSTLVIDGCSANVTGWIKTGDYFSVNGELKMVTADASTNGSGEVTVSFKPALRSSPADNA
PVTVINPTCLMVLTDDSQAMWETDANGIYNEITFSAVEVFA