TCDB is operated by the Saier Lab Bioinformatics Group
>WP_023647193.1 AIM24 family protein [actinobacterium LLX17]
MSAGWQPDPNGKHEYRYHDGNGWTEHVSNGGVASTDPYVAGPPPQGGQAGPPPQAQQGGDPFAGLSGDLVDGTFTEVEGV
GPQKQNERLLRVRIDQPFMAKQGAMVAYQGNVDFAYQGGGAAKFLKKAMTGEGLSLMQVSGAGDVFLADTAKHVHILRLA
NSGISVNGAAVLAFSSSLDWNVERVRGGSMAAGGLFNTTLRGSGWVAVTTDGNPVVLNPAEAPTFADANALVAWSVGLQT
SIKSSFTAGSLIGRGSGEAFQVAFSGAGFVIVQPSEGPQVPTQAG