TCDB is operated by the Saier Lab Bioinformatics Group
>WP_025803616.1 DUF935 family protein [Campylobacter corcagiensis]
MKEFLKPKREFIKTDLSYYTELTASRVRAALLTKNQQELFPLFNLLVDKDTSLGSECEKRLNSTLNKFFTHDLGESEDEN
IEEIIKASVEARLYGFSLLELYLENNFIKVSLVDRSYIEFRENLPTLRIGKNRFIAKEPFFITITSNPAMLKTLWIAYAK
HYVLSLYLKFAEFLGVPPLIGGATSSDEKTLKQMSEAFENLRSGSYAIFGVNDTIKILEGRGSQEDFMEFIRYCDAEIAK
CINGSVLSSNTATTGSYAQGKIHENNRFEIIDADIKFASRQVKNFYSRFNKKANLNIQYEKDKNLLQRAQMLSILYPLGY
EMSIDDMAKEFDLPLPKKEKLKSLNYKLPKKPLDKFDEFIESPNFKEPLKGVETMIKDSLNTLLKECNTYEEAFNKLYEI
YDGVPLDILENVMFSAMSNAEILGLSDEF