TCDB is operated by the Saier Lab Bioinformatics Group
>WP_029308938.1 DUF1275 domain-containing transporter [Cupriavidus metallidurans]
MLIPYLRRLTGKDRSPEANLQLARYLAFVAGATNAGGFLAVQQYTSHMSGILSAMADNLALGSLGLVLDGLGALIAFLSG
AACSAVLINWGRREQLQSTFALPLMVEAGLLVSFGLLGGNLEHHEWLFVPATVLVLCFIMGLQNAMVTKVSNAEIRTTHV
TGMVTDIGIELGKLFYWNLSRADSGKPVVLANRQKLRVLATLVGLFFVGGVVGALGFKHIGFSATLPLAILLLALAAVPV
VDDVRLRMWRQDFLSRIAARARRWSRTVKTDIHAIWLAARDPRTPWYAKVLAAVVAGYALSPIDLIPDFIPVIGYLDDVV
LVPLGILVVIRLIPEEVMKEHRAAASSAERRPASKMAAAAIIVIWTLSAFAIAHALPRLLASFFHP