TCDB is operated by the Saier Lab Bioinformatics Group
>WP_038680449.1 hypothetical protein [Rubrobacter radiotolerans]
MFSLAAAVYATYGFDGPLYRDYGIYLYGGQRLAEGVPPYAGIFDHKGPLPVALAGLGVIVSGWLGSDEVYTVRAVFFFAA
CLSAVAVYALGESAFRSRTVGFLAALTFLGFGGYSVAAGSGPEPKTPLVLFQALCLAAMFGKRWFWAGLLGALAALTWQP
TGILLVVGLALVLFRSAAERWSATARFVAGAAAPLVGTFLYYLYSGALRELFEGLLIFNLLRVSRSGGPPFVNPDRILHS
VGEGYGLMAPVAVLGLGAIVALYFSRPARRRFAPLLLSMPLFVLWSLTDFQVAQDFYVFLPYAAVGFGAMLAGVAAALAG
SAHAVRWGYGGAVVPVMGSLLLGAAVGGPLLDGTARPEPSLKEQRASAEEVRARLGEGARVASINAPQALALLGETNPNP
YLFITDGIDRQISAEHPGGFEGWLRDLERHDPDALAFFADAQRQPPDADLTERHDELLADWLYTNGYKAEKVGNFWLYVR
GQESRRPARGGRRSRHRRSRRPARRGSA