TCDB is operated by the Saier Lab Bioinformatics Group
>WP_044639816.1 DUF1761 domain-containing protein [Risungbinella massiliensis]
MEEYMSYNIWAVLLATFAYMAIGSFWYSPLLFGKVWMRELSITEKDLTDPKEAMLGALVTTFLSANILEVLLIISHSENA
LDGLWIGTLVGLVIGAVFATNSFFERKSWRLYLITIGYHFVAFLLMGSILGGW