TCDB is operated by the Saier Lab Bioinformatics Group
>WP_048084393.1 hypothetical protein [Methanobacterium formicicum]
MTPSTENKSFNTSLASFISTVSNPPLVAIPVFLVINYTLLYNGNWAWFSFLSIFFVSILPIITSSLWILRNNLEVDMPRR
EDRIYPLLLVILSYVVGVIVLFAAGAPSLTSALMVCYLNNTLIVLLFSLFWKISIHAMGIAGPATALIYLFGWPGLAFSL
VVPLVVWSRLHLKRHTPAQLITGTTLGYLLTALQLYLLLGF