TCDB is operated by the Saier Lab Bioinformatics Group
>WP_048380856.1 hypothetical protein [Corynebacterium renale]
MDLGFVQTALADFSTFAKNLVELFQGIPDFFAGLTGRVATDKVPAANWTELANETKGLFPKKNA