TCDB is operated by the Saier Lab Bioinformatics Group
>WP_048643629.1 DUF1679 domain-containing protein [Cyclobacterium amurskyense]
MPSIEYQILQCTEAKAIENAAHVQTLWSGYGTIKRYTLEGGKHRSVIVKHILLPESGKHPRGWNTDLSHQRKVRSYAVES
YWYQHYAPLTNPNCRVPQLLHAEAEGSMRLLIMEDLNVSGFPIRLTPETVSISAAKNCLTWLAHFHGKFMQVQPKGLWEI
GSYWYLDTRPDELAKMKNKSLKQMASAIDRRLNEAKFQTLLHGDAKVANFCFGSENQVAAVDFQYVGRGCGIKDVAYFIS
SCFAEEDCQHYEEELLRHYFNELESTMANPIDFQLVKQEWSALYKYAWADLYRFLDGWSDGHWKMHGYSKRLTQSVLKEL
NYV