TCDB is operated by the Saier Lab Bioinformatics Group
>WP_050771967.1 phosphatase PAP2 family protein [Maritimibacter alkaliphilus]
MQVPQTIRRLTERVETLTIVVILIVAGALWAFVGLVDEMIEGDLHAFDEAILMALRVPGDPSDAIGGPQVETAMRDLTAL
GGITVLTLLTLSVLAYLLLRGKRASALFLAVAIVGGQLLSHGFKTLFSRPRPDLVPHGVDVATASFPSGHSMMAAVTYLT
LAVMLARLDGHTKVRVFFVSLAAILALAVGVSRVYLGVHWPSDVLAGWTLGAAWALLVWLIARWLERRGRIDRETGG