TCDB is operated by the Saier Lab Bioinformatics Group
>WP_051862993.1 hypothetical protein [Xenorhabdus bovienii]
MRELTIQELDLVSGAGEAEIVGEIAGAAAGAQAGKVAGGWAGSYAGAAAGAALGSVVPGIGTVGGAIIGAIAGRVGGTYA
GGTAGGVAGRWAGGQIGSKIEQSRTQSGTDYCGCDYC