TCDB is operated by the Saier Lab Bioinformatics Group
>WP_058438292.1 hypothetical protein [Dehalogenimonas alkenigignens]
MDFILAILMVIIGAGIPAYWLNYWASGRLPLGFRTIVNGSYIVFHILAELVTAGLCLAAGAVIVFHGFPQARALVFLASG
ALIYAGVNSLGWSSLTDHRMVIIFLLVSLIAVAAALYAQTGWQQFG