TCDB is operated by the Saier Lab Bioinformatics Group
>WP_060765543.1 hypothetical protein [Escherichia fergusonii]
MMTKIKNINKIFIAISILFLILAIHPIFSSGIWTGSDWEVHAYRLSGVNYQISNHQFPLIFDFWSSNQQGYAWSLFYPPL
TTYLMALTYPIYALGISDLVQIKLIFLLLILFSFASCFYSTIKLSLSLKASILCAGIYICSPYFLTNIYVRFALGEVAAM
CFIPLFFLSLNYLILENKKFYITFITSSAGILLSNIPSCIPALLLALSFFLLNYKKINIFIIKKLLIASIFMIMACSFYI
FPLIYNFIYGDIYAFSGMSRNYEYMYNSAPGIYDAAINGFTGTSNKFYLSLGIAQLILTICALLKKVKMIRVCSALSLIL
FIMSTKLFPWNLINESMPIINIMQFPWRLLSTATILSSICTAYMLTTNSREVMITACVVIFITSVSVFSGSSLEKRSSLV
RNSFYPDYLNNTAAAPENYDYVKKVSISNQPVKLIHFEEGYPVYEVNSKESTEITLPVIFYHGYKIKIGNIITLPQNNRG
LISLAVPAGVSVLQLKYDYEYIIISYLISAVSILVMYLCHRRYLNLRDEG