TCDB is operated by the Saier Lab Bioinformatics Group
>WP_081449648.1 DUF87 domain-containing protein [Cellulomonas flavigena]
MSSEPLAQWWFWVAATTALTLALVEPYYTGVQAAMLFGAAGLAAGLTADRAGVEPLWIGHVVLAGAVFVAALTALASQPG
RLRDGSRWVATRFGRPLWLGLSAVTIEALRQAASGAPTIAMTLAGGTLAAVLVAAPDWYRLVGVAQPAPDGIAIFETAVE
PNLMLLATDRRYTPGAYVEVHGVTASRGVVVGNLAHKGGNRIQVALEEPWHEVADSSGQQCEVVTLSHPPARAVAFVSEG
STDRVLSLRPFGGLVRGDTVYWEEATSGARYLYQVVARELAREMWDASSVVTERATAVLLGAAGPGGLTPGTALPAPYVP
VLSADEVTGPLAPGFERIGTIAGTALPFGVSVAQLRGHHLAILGMSGMGKSTVARRLIDLMSSASVVVSLDGTGEYRARF
GLPAWNDAVGLTTPGAWVYEPAGVPALRVSEFIKMAMTQAAAEYAVGDPLRRTVLLEEAHSYLPEWNFVADRNESSYVAQ
SCRYILQARKFGLSFILVSQRTAVISKSALSQCESYIALRTLDATSLEYLEGVLGSQFRETVSGLQRYQAVCAGPAFSTS
TPVVVNLDPYPAPPPAGPPTSTGAPTTASHTGV