TCDB is operated by the Saier Lab Bioinformatics Group
>WP_082335051.1 GHKL domain-containing protein [Ruminococcus flavefaciens]
MLRILFTMGDCIRIILIITAALNYKFVRSWKPIVLGAASAIGYLVASYLSPENVDLFNFILGMLTIVICSLAVEGKKKLI
FTAAVFFIISMVDESLFFAARSITGIPYAELATGELYQIVIMSISFIIFFAIAMILRKVNLKTSEKPDLKNSNSFYIAML
FVGSIVSLLSISAYNYKSGHSSISLFVISLLVLTLCGFFVYNNASKKYYQNTTRMNEKIMTAQKEYYESLLERESDTRKF
RHDINNHMFCIKTLIDEGKYDEAEQYINGIDNKMGKLKTKYSTGNSLVNAIVNDIAGKYDGVELDWKGLVPEDLKISNMD
VCIIFSNLLDNAFCAASGCEKEKNVAVTIKSVANSLVMTIKNNISAPIRTKDSKLITSKPDKKNHGLGTMNVKECVAVNG
GSVEYSYTDSDFTVDVVLPNVVEM