TCDB is operated by the Saier Lab Bioinformatics Group
>WP_087373909.1 AIM24 family protein [Butyricicoccus pullicaecorum]
MRTAIGTRENMRVLEEFESGGLRVEVLEYEKLCGLTAPSMAQAVYFMEQQHIRARQIALYLTDEKVTVNRGAMSYFQGNL
QMVSGVTVGNALGRMLRGAVTGESMSQPEYTGTGLLVLEPSFKHFLVLELAPGERVIVDDGMFFCAQGSVGVRAAAQRTI
SSAALGGESLFQTELTGPGIIILESAVPMSEIDVIDLANDTLRVDGNFAVLRSANLDFTVERSAKTLIGSAVSGEGLVNV
YRGTGQVWLAPTLKVYDNLTAALCPPPLVSKKD