TCDB is operated by the Saier Lab Bioinformatics Group
>WP_088641900.1 phosphatase PAP2 family protein [Micromonospora wenchangensis]
MGAATRVARWVTEVTAPAVLVTGLTVVIGWHGAGGVRGLAWGLLATVFAAVIPFAYVLSGVRRGRFTDHHIGRREQRRVP
LLFGLVSAAAGLALLAALGAPRPVLALVATGVVGLVVAVSVSHWWKMSIHSAVAAGTLVVLVLTFGPRLLPAVPLLGLVG
WSRVRLRDHTVAQVVAGGLVGALVAGLVFAALS