TCDB is operated by the Saier Lab Bioinformatics Group
>WP_088857572.1 hypothetical protein [Thermococcus profundus]
MDQIRKWTFYLIILVAGFAMGIGTVGLFPQMWLKYGINGLLVHIAFLAVLTYLAILEAENVMKSGYYFTELYTKISQKPG
MILAILTVNVIFLSYYTANTALSILVPVLGTGTVARLVAKLVMIILVGLIITRAKDKTFAIMAIGALILVFLVPLLTLLF
KTQIASNAEYLNLAWNMLVAKKAISAEMIRAAADRALYGVGLGFGFYIMLGSFMNERFNARLIIGTGVFLQLILGILSTF
AVIYAVTPSDPDLFIKYAGGGEEAAIELMGSFPKILSNHSFLLAVMGLTIFMAGLTSLLPTAEVGVQIIESTFRMGRSRA
ALYLLAAVAVVGVFDSPPSIADVLLKGVTTSLAVTAIFEAYPLISGTKKPKTAQLAVIGTAVLLFVLGFITQSYYDAKLG
GAYYISIVLAIFVAALGFLGEGLLPGS