TCDB is operated by the Saier Lab Bioinformatics Group
>WP_092929777.1 hypothetical protein [Actinopolyspora alba]
MDKSSSHEMPPDEALGRAGRMSELARDGSRWFGYMLILLGLVTTVFFAGQALAQGWIAAAFAWLYAACIAGLFWYVNRQR
VVSRETPRITRAVTIAYAALVILTSVITSTWLDDEPLWQCLLALLPALPCWSAAWWVLRR